CacheBy
Atlas Antibodies Anti-CRISPLD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRISPLD2 Antibody

상품 한눈에 보기

인간 CRISPLD2 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030054-100 Anti-CRISPLD2 Antibody, cysteine rich secretory protein LCCL domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030054-25 Anti-CRISPLD2 Antibody, cysteine rich secretory protein LCCL domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRISPLD2 Antibody

Anti-CRISPLD2 Antibody

Full Name: Cysteine Rich Secretory Protein LCCL Domain Containing 2
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CRISPLD2.


Alternative Gene Names

  • DKFZP434B044
  • LCRISP2
  • LGL1

Open Datasheet (PDF)


Target Information

  • Target Protein: Cysteine rich secretory protein LCCL domain containing 2
  • Target Gene: CRISPLD2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000031825): 78%
  • Rat (ENSRNOG00000016752): 78%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

면역세포화학 (ICC) 등 다양한 면역학적 분석에 적합합니다.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.