
원본
Atlas Antibodies Anti-CRISP1 Antibody
상품 한눈에 보기
Human CRISP1 단백질에 특이적인 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합함. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화정제됨. Human에 반응하며, RNA-seq 데이터와 비교한 Orthogonal Validation 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030534-100 Anti-CRISP1 Antibody, cysteine rich secretory protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030534-25 Anti-CRISP1 Antibody, cysteine rich secretory protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CRISP1 Antibody
Anti-CRISP1 Antibody
Cysteine-rich secretory protein 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CRISP1
Alternative Gene Names
AEGL1, ARP, CRISP-1, HSCRISP1D, HSCRISP1G, HUMARP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cysteine-rich secretory protein 1 |
| Target Gene | CRISP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000025774 (68%), Rat ENSRNOG00000013612 (68%) |
Antigen Sequence:
LYVCHYCHEGNDPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDIQVHYLGCNHSTTILFCKATCLC
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



