
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CREB3L4 Antibody
상품 한눈에 보기
Human CREB3L4 단백질을 인식하는 rabbit polyclonal 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal validation 수행. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038122-100 Anti-CREB3L4 Antibody, cAMP responsive element binding protein 3-like 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038122-25 Anti-CREB3L4 Antibody, cAMP responsive element binding protein 3-like 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CREB3L4 Antibody
Anti-CREB3L4 Antibody
cAMP responsive element binding protein 3-like 4
Recommended Applications
- Immunohistochemistry (IHC) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CREB3L4.
Alternative Gene Names
AIbZIP, ATCE1, CREB3, CREB4, hJAL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cAMP responsive element binding protein 3-like 4 |
| Target Gene | CREB3L4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000027938 (72%), Rat ENSRNOG00000023493 (71%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



