Atlas Antibodies Anti-CRABP2 Antibody

상품 한눈에 보기

인간 CRABP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. 정제된 PrEST 항원 기반 친화 정제 방식 사용. 인간 반응성 검증 및 쥐·마우스와 높은 서열 유사성 보유. 안정적인 PBS/glycerol 버퍼에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004135-100 Anti-CRABP2 Antibody, cellular retinoic acid binding protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004135-25 Anti-CRABP2 Antibody, cellular retinoic acid binding protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

cellular retinoic acid binding protein 2

IHC (Immunohistochemistry)
WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against Human CRABP2.

항목	내용
Target Protein	Cellular retinoic acid binding protein 2
Target Gene	CRABP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000022101 (95%), Mouse ENSMUSG00000004885 (95%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand