CacheBy
Atlas Antibodies Anti-CPT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPT2 Antibody

상품 한눈에 보기

Human CPT2 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. Orthogonal validation으로 단백질 발현 신뢰성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028202-100 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028202-25 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPT2 Antibody

Anti-CPT2 Antibody

Target: Carnitine palmitoyltransferase 2 (CPT2)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human CPT2.

Alternative Gene Names

CPT1, CPTASE

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Carnitine palmitoyltransferase 2
Target Gene CPT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence CKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRF
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000028607 (90%), Rat ENSRNOG00000012443 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.