CacheBy
Atlas Antibodies Anti-CPQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPQ Antibody

상품 한눈에 보기

Human CPQ 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합. RNA-seq 데이터와의 비교를 통한 정교한 단백질 발현 검증 제공. Affinity purification 방식으로 높은 특이성과 재현성 확보.

카탈로그번호
HPA023235-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023235-100 Anti-CPQ Antibody, carboxypeptidase Q 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023235-25 Anti-CPQ Antibody, carboxypeptidase Q 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPQ Antibody

Anti-CPQ Antibody

Target Protein: carboxypeptidase Q (CPQ)

  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CPQ.

Alternative Gene Names

  • LDP
  • PGCP

Open Datasheet

Antigen Information

Antigen Sequence (PrEST antigen):
YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000039007 94%
Rat ENSRNOG00000005931 91%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.