
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CPQ Antibody
상품 한눈에 보기
Human CPQ 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합. RNA-seq 데이터와의 비교를 통한 정교한 단백질 발현 검증 제공. Affinity purification 방식으로 높은 특이성과 재현성 확보.
- 카탈로그번호
- HPA023235-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023235-100 Anti-CPQ Antibody, carboxypeptidase Q 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023235-25 Anti-CPQ Antibody, carboxypeptidase Q 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CPQ Antibody
Anti-CPQ Antibody
Target Protein: carboxypeptidase Q (CPQ)
Recommended Applications
- Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CPQ.
Alternative Gene Names
- LDP
- PGCP
Antigen Information
Antigen Sequence (PrEST antigen):
YERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000039007 | 94% |
| Rat | ENSRNOG00000005931 | 91% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



