CacheBy
Atlas Antibodies Anti-CPNE2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPNE2 Antibody

상품 한눈에 보기

Human CPNE2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성을 가지며, glycerol/PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041132-100 Anti-CPNE2 Antibody, copine II 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041132-25 Anti-CPNE2 Antibody, copine II 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPNE2 Antibody

Anti-CPNE2 Antibody

Target Information

  • Target Protein: copine II
  • Target Gene: CPNE2
  • Alternative Gene Names: CPN2

Product Description

Polyclonal antibody against Human CPNE2 (copine II).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000034361): 98%
  • Rat (ENSRNOG00000043286): 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.