CacheBy
Atlas Antibodies Anti-CPD Antibody
원본

Atlas Antibodies Anti-CPD Antibody

상품 한눈에 보기

인체 CPD 단백질을 표적으로 하는 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human에 특이적이며 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055465-100 Anti-CPD Antibody, carboxypeptidase D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055465-25 Anti-CPD Antibody, carboxypeptidase D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPD Antibody

Anti-CPD Antibody

Target Information

  • Target Protein: Carboxypeptidase D
  • Target Gene: CPD
  • Alternative Gene Names: GP180

Product Description

Polyclonal antibody against Human CPD.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTVAIPNILSGTSSSYQPIQPKDFHHHH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000020841): 76%
  • Rat (ENSRNOG00000003873): 75%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.