CacheBy
Atlas Antibodies Anti-CPA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPA3 Antibody

상품 한눈에 보기

Human CPA3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터 기반 정교한 Orthogonal 검증을 거쳤습니다. PBS/glycerol 버퍼에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006479-100 Anti-CPA3 Antibody, carboxypeptidase A3 (mast cell) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006479-25 Anti-CPA3 Antibody, carboxypeptidase A3 (mast cell) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPA3 Antibody

Anti-CPA3 Antibody

Target: carboxypeptidase A3 (mast cell)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CPA3.

Open Datasheet


Target Information

항목 내용
Target Protein carboxypeptidase A3 (mast cell)
Target Gene CPA3
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence RFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHVAANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYNNWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNER

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Identity
Rat ENSRNOG00000011181 77%
Mouse ENSMUSG00000001865 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.