AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COX16 Antibody
상품 한눈에 보기
인간 COX16 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC에 적합. 토끼 숙주에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 생쥐 및 랫드와 83% 서열 동일성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062659-100 Anti-COX16 Antibody, COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062659-25 Anti-COX16 Antibody, COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COX16 Antibody
Anti-COX16 Antibody
COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human COX16
Alternative Gene Names
C14orf112, HSPC203
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) |
| Target Gene | COX16 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021139 (83%), Rat ENSRNOG00000047115 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.