CacheBy
Atlas Antibodies Anti-COX16 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COX16 Antibody

상품 한눈에 보기

인간 COX16 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC에 적합. 토끼 숙주에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제됨. 인간에 반응하며 생쥐 및 랫드와 83% 서열 동일성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062659-100 Anti-COX16 Antibody, COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062659-25 Anti-COX16 Antibody, COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COX16 Antibody

Anti-COX16 Antibody

COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human COX16

Alternative Gene Names

C14orf112, HSPC203

Open Datasheet

Target Information

항목 내용
Target Protein COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
Target Gene COX16
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKT
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000021139 (83%), Rat ENSRNOG00000047115 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.