CacheBy
Atlas Antibodies Anti-COQ7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COQ7 Antibody

상품 한눈에 보기

Human COQ7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합. CAT5, CLK-1 등 대체 유전자명으로도 알려짐. 고순도 친화 정제 제품이며, 보존용으로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071922-100 Anti-COQ7 Antibody, coenzyme Q7 homolog, ubiquinone (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071922-25 Anti-COQ7 Antibody, coenzyme Q7 homolog, ubiquinone (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COQ7 Antibody

Anti-COQ7 Antibody

Target: coenzyme Q7 homolog, ubiquinone (yeast)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human COQ7.

Alternative Gene Names

CAT5, CLK-1

Open Datasheet (PDF)

Target Information

  • Target Protein: coenzyme Q7 homolog, ubiquinone (yeast)
  • Target Gene: COQ7

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030652 88%
Rat ENSRNOG00000017012 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.