CacheBy
Atlas Antibodies Anti-COPS7B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COPS7B Antibody

상품 한눈에 보기

Human COPS7B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 갖습니다. 40% 글리세롤 및 PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034675-100 Anti-COPS7B Antibody, COP9 signalosome subunit 7B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034675-25 Anti-COPS7B Antibody, COP9 signalosome subunit 7B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COPS7B Antibody

Anti-COPS7B Antibody

Target Information

  • Target Protein: COP9 signalosome subunit 7B
  • Target Gene: COPS7B
  • Alternative Gene Name: CSN7B
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human COPS7B.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    GELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSV

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000018723): 99%
    • Mouse (ENSMUSG00000026240): 99%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 따라 결정해야 합니다.

Additional Resources

Open Datasheet (PDF)

제품 이미지

IHC Recommended
WB Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.