Atlas Antibodies Anti-COPG1 Antibody

상품 한눈에 보기

인간 COPG1 단백질을 인식하는 폴리클로날 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 및 설치류와 높은 서열 동일성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037866-100 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037866-25 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: coatomer protein complex, subunit gamma 1
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human COPG1.

항목	내용
Target Protein	coatomer protein complex, subunit gamma 1
Target Gene	COPG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000030058 (99%), Rat ENSRNOG00000010474 (99%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand