CacheBy
Atlas Antibodies Anti-COL17A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL17A1 Antibody

상품 한눈에 보기

인체 COL17A1 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 수행. BP180/BPAG2 대체 유전자명 포함. 고순도 Affinity 정제, 인간 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043673-100 Anti-COL17A1 Antibody, collagen, type XVII, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043673-25 Anti-COL17A1 Antibody, collagen, type XVII, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL17A1 Antibody

Anti-COL17A1 Antibody

Target: collagen, type XVII, alpha 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human COL17A1

Alternative Gene Names

BP180, BPAG2

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein collagen, type XVII, alpha 1
Target Gene COL17A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
DGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHGSSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTR
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012110 (92%), Mouse ENSMUSG00000025064 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.