Atlas Antibodies Anti-COA1 Antibody

상품 한눈에 보기

Human COA1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응하며, cytochrome c oxidase assembly factor 1 연구에 활용됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011944-100 Anti-COA1 Antibody, cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011944-25 Anti-COA1 Antibody, cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-COA1 Antibody

Anti-COA1 Antibody

Target: cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae)

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human COA1

Alternative Gene Names

C7orf44, FLJ10803, MITRAC15

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae)
Target Gene	COA1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000033987 (24%), Rat ENSRNOG00000004171 (23%)

Antigen Sequence:

HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand