CacheBy
Atlas Antibodies Anti-CNTN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNTN1 Antibody

상품 한눈에 보기

Human CNTN1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 등 다양한 응용에 적합하며, Human과 Mouse 반응성이 검증되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 안정성을 위해 글리세롤과 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070467-100 Anti-CNTN1 Antibody, contactin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070467-25 Anti-CNTN1 Antibody, contactin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNTN1 Antibody

Anti-CNTN1 Antibody

Target Information

  • Target Protein: Contactin 1
  • Target Gene: CNTN1
  • Alternative Gene Names: F3, GP135

Product Description

Polyclonal antibody against human CNTN1 (Contactin 1).

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000004438 92%
Mouse ENSMUSG00000055022 92%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.