CacheBy
Atlas Antibodies Anti-CNR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNR1 Antibody

상품 한눈에 보기

인간 CNR1을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 연구 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간, Rat, Mouse에서 높은 교차 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069945-100 Anti-CNR1 Antibody, cannabinoid receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069945-25 Anti-CNR1 Antibody, cannabinoid receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNR1 Antibody

Anti-CNR1 Antibody

Target Information

  • Target Protein: Cannabinoid receptor 1
  • Target Gene: CNR1
  • Alternative Gene Names: CANN6, CB-R, CB1, CB1A, CB1K5, CNR

Product Description

Polyclonal antibody against human CNR1.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008223 (100%)
  • Mouse ENSMUSG00000044288 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.