CacheBy
Atlas Antibodies Anti-CNOT9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNOT9 Antibody

상품 한눈에 보기

Human CNOT9 단백질을 인식하는 Rabbit Polyclonal 항체로, CCR4-NOT 전사 복합체 서브유닛 9을 타겟으로 함. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human, Mouse, Rat에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046622-100 Anti-CNOT9 Antibody, CCR4-NOT transcription complex subunit 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046622-25 Anti-CNOT9 Antibody, CCR4-NOT transcription complex subunit 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNOT9 Antibody

Anti-CNOT9 Antibody

Target: CCR4-NOT transcription complex subunit 9
Type: Polyclonal Antibody against Human CNOT9


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against Human CNOT9, a subunit of the CCR4-NOT transcription complex.


Alternative Gene Names

CAF40, CT129, RCD1, RCD1+, RQCD1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein CCR4-NOT transcription complex subunit 9
Target Gene CNOT9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026174 (100%), Rat ENSRNOG00000016034 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.