CacheBy
Atlas Antibodies Anti-CNKSR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNKSR1 Antibody

상품 한눈에 보기

Human CNKSR1 단백질을 인식하는 폴리클로날 래빗 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. CNK, CNK1, KSR 유전자와 관련된 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030847-100 Anti-CNKSR1 Antibody, connector enhancer of kinase suppressor of Ras 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030847-25 Anti-CNKSR1 Antibody, connector enhancer of kinase suppressor of Ras 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNKSR1 Antibody

Anti-CNKSR1 Antibody

Target: connector enhancer of kinase suppressor of Ras 1 (CNKSR1)
Type: Polyclonal Antibody against Human CNKSR1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Alternative Gene Names

CNK, CNK1, KSR

Open Datasheet (PDF)

Target Information

  • Target Protein: connector enhancer of kinase suppressor of Ras 1
  • Target Gene: CNKSR1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQNRE

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Identity (%)
Rat ENSRNOG00000022838 90
Mouse ENSMUSG00000028841 86

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.