AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CNBP Antibody
상품 한눈에 보기
인간 CNBP 단백질에 대한 고품질 폴리클로날 항체. WB 및 ICC 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제. 인간, 쥐, 생쥐 등에서 높은 반응성 확인. 안정한 PBS/glycerol 버퍼에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063097-100 Anti-CNBP Antibody, CCHC-type zinc finger, nucleic acid binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063097-25 Anti-CNBP Antibody, CCHC-type zinc finger, nucleic acid binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CNBP Antibody
Anti-CNBP Antibody
Target: CCHC-type zinc finger, nucleic acid binding protein
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CNBP.
Alternative Gene Names
CNBP1, DM2, RNF163, ZCCHC22, ZNF9
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CCHC-type zinc finger, nucleic acid binding protein |
| Target Gene | CNBP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000010239 (100%), Mouse ENSMUSG00000030057 (100%) |
Antigen Sequence:
GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.