CacheBy
Atlas Antibodies Anti-CMTM5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CMTM5 Antibody

상품 한눈에 보기

인체 CMTM5 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Rabbit IgG로 제작되어 높은 특이성과 재현성을 제공. Recombinant Epitope 기반 정제 방식으로 인체 반응성 확인. 다양한 조직 발현 비교 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052338-100 Anti-CMTM5 Antibody, CKLF-like MARVEL transmembrane domain containing 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052338-25 Anti-CMTM5 Antibody, CKLF-like MARVEL transmembrane domain containing 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CMTM5 Antibody

Anti-CMTM5 Antibody

CKLF-like MARVEL transmembrane domain containing 5

  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CMTM5

Alternative Gene Names

CKLFSF5, FLJ37521

Open Datasheet

Target Information

항목 내용
Target Protein CKLF-like MARVEL transmembrane domain containing 5
Target Gene CMTM5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000040759 (69%), Rat ENSRNOG00000016828 (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.