Atlas Antibodies Anti-CMKLR1 Antibody

상품 한눈에 보기

Human CMKLR1을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% glycerol 기반 PBS 버퍼에 보존제로 sodium azide 포함.

카탈로그번호: HPA047865-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047865-100 Anti-CMKLR1 Antibody, chemokine-like receptor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047865-25 Anti-CMKLR1 Antibody, chemokine-like receptor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CMKLR1 Antibody

Anti-CMKLR1 Antibody

Target Information

Target Protein: Chemokine-like receptor 1
Target Gene: CMKLR1
Alternative Gene Names: RVER1

Recommended Applications

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CMKLR1, generated in rabbit. Designed to detect chemokine-like receptor 1 with high specificity.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat ENSRNOG00000000704 (82%)
Mouse ENSMUSG00000042190 (80%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand