CacheBy
Atlas Antibodies Anti-CMA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CMA1 Antibody

상품 한눈에 보기

Human CMA1 단백질을 인식하는 폴리클로날 항체로, IHC 분석에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 정제되었습니다. RNA-seq 데이터 기반 Orthogonal validation 완료. Human에 반응성이 검증된 고품질 연구용 항체.

카탈로그번호
HPA052634-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052634-100 Anti-CMA1 Antibody, chymase 1, mast cell 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052634-25 Anti-CMA1 Antibody, chymase 1, mast cell 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CMA1 Antibody

Anti-CMA1 Antibody

Target: chymase 1, mast cell
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CMA1
Open Datasheet


Target Information

항목 내용
Target Protein chymase 1, mast cell
Target Gene CMA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000022225 67%
Rat ENSRNOG00000020563 63%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative). Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.