
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLUAP1 Antibody
상품 한눈에 보기
Human CLUAP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 일치도를 보입니다. 보존용으로 글리세롤과 PBS 버퍼에 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036976-100 Anti-CLUAP1 Antibody, clusterin associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036976-25 Anti-CLUAP1 Antibody, clusterin associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLUAP1 Antibody
Anti-CLUAP1 Antibody
Target: Clusterin associated protein 1 (CLUAP1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human CLUAP1.
Recommended for use in immunohistochemistry and related applications.
Alternative Gene Names
CFAP22, FAP22, FLJ13297, KIAA0643
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000007117 (90%)
- Mouse ENSMUSG00000014232 (89%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Note | Gently mix before use. Determine optimal concentrations and conditions empirically. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



