CacheBy
Atlas Antibodies Anti-CLTB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLTB Antibody

상품 한눈에 보기

인간 CLTB 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제된 고품질 항체이며, RNA-seq 데이터 기반 정교한 Orthogonal 검증을 통해 단백질 발현을 확인합니다. 휴먼 반응성 검증 완료, 토끼 IgG 호스트.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036458-100 Anti-CLTB Antibody, clathrin, light chain B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036458-25 Anti-CLTB Antibody, clathrin, light chain B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLTB Antibody

Anti-CLTB Antibody

Target: clathrin, light chain B
Supplier: Atlas Antibodies


  • WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CLTB


Alternative Gene Names

  • Lcb

Target Information

항목 내용
Target Protein clathrin, light chain B
Target Gene CLTB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000047547 (88%)
  • Rat ENSRNOG00000017506 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.