
Atlas Antibodies Anti-CLTB Antibody
상품 한눈에 보기
인간 CLTB 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제된 고품질 항체이며, RNA-seq 데이터 기반 정교한 Orthogonal 검증을 통해 단백질 발현을 확인합니다. 휴먼 반응성 검증 완료, 토끼 IgG 호스트.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLTB Antibody
Target: clathrin, light chain B
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CLTB
Alternative Gene Names
- Lcb
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | clathrin, light chain B |
| Target Gene | CLTB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000047547 (88%)
- Rat ENSRNOG00000017506 (88%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




