
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLSPN Antibody
상품 한눈에 보기
Human CLSPN 단백질을 표적으로 하는 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 인간에 대한 반응성이 검증됨. 안정한 PBS/glycerol 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026312-100 Anti-CLSPN Antibody, claspin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026312-25 Anti-CLSPN Antibody, claspin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLSPN Antibody
Anti-CLSPN Antibody
Target Information
- Target Protein: Claspin
- Target Gene: CLSPN
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SFVILEPETNRELEALKQRFWKHANPAAKPRAGQTVNVNVIVKDMGTDGKEELKADVVPVTLAPKKLDGASHTKPGEKLQVLKAKLQEAMKLRR
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000011332 (87%)
- Mouse: ENSMUSG00000042489 (85%)
Product Description
Polyclonal antibody against human CLSPN.
Clonality and Isotype
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



