CacheBy
Atlas Antibodies Anti-CLPTM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLPTM1 Antibody

상품 한눈에 보기

인간 CLPTM1 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용해 친화 정제됨. 면역형광(ICC) 등 다양한 응용에 적합. 인간에 대한 높은 특이성과 검증된 반응성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068702-100 Anti-CLPTM1 Antibody, cleft lip and palate associated transmembrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068702-25 Anti-CLPTM1 Antibody, cleft lip and palate associated transmembrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLPTM1 Antibody

Anti-CLPTM1 Antibody

cleft lip and palate associated transmembrane protein 1 (CLPTM1)을 인식하는 항체입니다.

  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CLPTM1

Open Datasheet

Target Information

항목 내용
Target Protein cleft lip and palate associated transmembrane protein 1
Target Gene CLPTM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KITKVMDVRLDREHRVAGIFPRLSFKDKSTYIESSTKVYDDMAFRY

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000002981 93%
Rat ENSRNOG00000018255 91%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide가 보존제로 포함되어 있습니다.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.