CacheBy
Atlas Antibodies Anti-CLNK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLNK Antibody

상품 한눈에 보기

인간 CLNK 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 완충액에 보존됩니다. 사람에 특이적으로 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035671-100 Anti-CLNK Antibody, cytokine-dependent hematopoietic cell linker 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035671-25 Anti-CLNK Antibody, cytokine-dependent hematopoietic cell linker 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLNK Antibody

Anti-CLNK Antibody

Target: Cytokine-dependent hematopoietic cell linker (CLNK)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CLNK protein.


Alternative Gene Names

  • MIST

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Cytokine-dependent hematopoietic cell linker
Target Gene CLNK
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence PIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPL

Species Reactivity

항목 내용
Verified Species Reactivity Human
Ortholog Identity Mouse (59%), Rat (56%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.