CacheBy
Atlas Antibodies Anti-PSMC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMC2 Antibody

상품 한눈에 보기

Human PSMC2 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. WB 및 IHC에 적합하며, 독립 항체 검증으로 신뢰성 향상. PrEST 항원 기반 정제 및 다양한 종(인간, 마우스, 랫트)에 반응.

카탈로그번호
HPA019238-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019238-100 Anti-PSMC2 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019238-25 Anti-PSMC2 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMC2 Antibody

Anti-PSMC2 Antibody

Target Protein: proteasome (prosome, macropain) 26S subunit, ATPase, 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human PSMC2.


Alternative Gene Names

MSS1, Nbla10058, S7

Open Datasheet


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012026 (100%)
  • Mouse ENSMUSG00000028932 (99%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.