CacheBy
Atlas Antibodies Anti-PSMA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMA3 Antibody

상품 한눈에 보기

Human PSMA3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 호스트에서 생산되었으며, 높은 종 간 반응성(인간, 마우스, 랫드)을 보임. Affinity purification 방식으로 정제된 고품질 항체.

카탈로그번호
HPA000905-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000905-100 Anti-PSMA3 Antibody, proteasome (prosome, macropain) subunit, alpha type, 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000905-25 Anti-PSMA3 Antibody, proteasome (prosome, macropain) subunit, alpha type, 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMA3 Antibody

Anti-PSMA3 Antibody

Target Information

  • Target Protein: proteasome (prosome, macropain) subunit, alpha type, 3
  • Target Gene: PSMA3
  • Alternative Gene Names: HC8

Product Description

Polyclonal Antibody against Human PSMA3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000060073 (98%)
  • Rat ENSRNOG00000007851 (98%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.