Atlas Antibodies Anti-PSIP1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA019697-100 | - | Atlas Antibodies HPA019697-100 Anti-PSIP1 Antibody, PC4 and SFRS1 interacting protein 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA019697-25 | - | Atlas Antibodies HPA019697-25 Anti-PSIP1 Antibody, PC4 and SFRS1 interacting protein 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PSIP1 Antibody
PC4 and SFRS1 interacting protein 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PSIP1
Alternative Gene Names
LEDGF, p52, p75, PSIP2
Target Protein
PC4 and SFRS1 interacting protein 1
Target Gene
PSIP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000011498 (83%)
Mouse ENSMUSG00000028484 (81%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|