CacheBy
Atlas Antibodies Anti-PRRT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRRT3 Antibody

상품 한눈에 보기

Human PRRT3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 PBS 버퍼에 보존제로 sodium azide 포함.

카탈로그번호
HPA069859-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069859-100 Anti-PRRT3 Antibody, proline rich transmembrane protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069859-25 Anti-PRRT3 Antibody, proline rich transmembrane protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRRT3 Antibody

Anti-PRRT3 Antibody

Target: Proline-rich transmembrane protein 3 (PRRT3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRRT3.


Alternative Gene Names

  • FLJ33674

Open Datasheet


Antigen Information

Antigen Sequence (PrEST):
PLENSEIPMIPGAHPKGSVGSEPQAFDVFPENPRADSHRNSDVRHAPAEEMPEKPVASPLGPALYGPKAAQGAQRERLPVTDDLQMAQGPSSH


Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse: ENSMUSG00000045009 (49%)
  • Rat: ENSRNOG00000009863 (48%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.