CacheBy
Atlas Antibodies Anti-PRRT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRRT1 Antibody

상품 한눈에 보기

Human PRRT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. C6orf31, IFITMD7, NG5 유전자 대체명으로도 알려져 있으며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 반응성(인간, 마우스, 랫트) 확인됨.

카탈로그번호
HPA055149-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055149-100 Anti-PRRT1 Antibody, proline-rich transmembrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055149-25 Anti-PRRT1 Antibody, proline-rich transmembrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRRT1 Antibody

Anti-PRRT1 Antibody

Target: proline-rich transmembrane protein 1 (PRRT1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PRRT1 (proline-rich transmembrane protein 1).

Alternative Gene Names

C6orf31, IFITMD7, NG5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein proline-rich transmembrane protein 1
Target Gene PRRT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000015476 (95%), Rat ENSRNOG00000000433 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.