CacheBy
Atlas Antibodies Anti-PRRC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRRC1 Antibody

상품 한눈에 보기

Human PRRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA039212-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039212-100 Anti-PRRC1 Antibody, proline-rich coiled-coil 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039212-25 Anti-PRRC1 Antibody, proline-rich coiled-coil 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRRC1 Antibody

Anti-PRRC1 Antibody

Target Protein: proline-rich coiled-coil 1 (PRRC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PRRC1 (proline-rich coiled-coil 1).


Alternative Gene Names

  • FLJ32875

Open Datasheet


Target Information

항목 내용
Target Protein proline-rich coiled-coil 1
Target Gene PRRC1
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024594 (98%), Rat ENSRNOG00000016433 (98%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVH

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Recommended
WB Recommended

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.