
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRMT2 Antibody
상품 한눈에 보기
Human PRMT2 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC 등 다양한 응용에 적합. PRMT2 관련 연구에 활용 가능하며, 고순도의 Affinity purified 제품. Human, Mouse, Rat 반응성 확인됨.
- 카탈로그번호
- HPA029591-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029591-100 Anti-PRMT2 Antibody, protein arginine methyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029591-25 Anti-PRMT2 Antibody, protein arginine methyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRMT2 Antibody
Anti-PRMT2 Antibody
Protein Arginine Methyltransferase 2 (PRMT2)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PRMT2.
Alternative Gene Names
HRMT1L1, MGC111373
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein Arginine Methyltransferase 2 |
| Target Gene | PRMT2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSW |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001297 | 94% |
| Mouse | ENSMUSG00000020230 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



