Atlas Antibodies Anti-PRM2 Antibody

상품 한눈에 보기

Human PRM2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation 완료. Recombinant PrEST 항원으로 정제되었으며, 40% glycerol/PBS buffer에 보존. Human 반응성 확인 및 Mouse, Rat 유사 서열 51%.

카탈로그번호: HPA056386-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056386-100 Anti-PRM2 Antibody, protamine 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056386-25 Anti-PRM2 Antibody, protamine 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PRM2 Antibody

Anti-PRM2 Antibody

Target Protein: protamine 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human PRM2.

Alternative Gene Names

CT94.2

Open Datasheet (PDF)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000038015	51%
Rat	ENSRNOG00000002539	51%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand