CacheBy
Atlas Antibodies Anti-PRM2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRM2 Antibody

상품 한눈에 보기

Human PRM2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation 완료. Recombinant PrEST 항원으로 정제되었으며, 40% glycerol/PBS buffer에 보존. Human 반응성 확인 및 Mouse, Rat 유사 서열 51%.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA056386-100 Anti-PRM2 Antibody, protamine 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056386-25 Anti-PRM2 Antibody, protamine 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRM2 Antibody

Anti-PRM2 Antibody

Target Protein: protamine 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human PRM2.


Alternative Gene Names

  • CT94.2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000038015 51%
Rat ENSRNOG00000002539 51%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.