
원본
Atlas Antibodies Anti-PRKX Antibody
상품 한눈에 보기
Human PRKX 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 고순도의 Affinity 정제 방식으로 제조되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정성이 우수합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA015324-100 Anti-PRKX Antibody, protein kinase, X-linked 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015324-25 Anti-PRKX Antibody, protein kinase, X-linked 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRKX Antibody
Anti-PRKX Antibody
Target Protein: protein kinase, X-linked
Product Type: Polyclonal Antibody against Human PRKX
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody targets the human PRKX (protein kinase, X-linked) protein. It is affinity purified using the PrEST antigen as an affinity ligand for high specificity and performance.
Alternative Gene Names
- PKX1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein kinase, X-linked |
| Target Gene | PRKX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000035725 (82%), Rat ENSRNOG00000060168 (80%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



