Atlas Antibodies Anti-PRKD2 Antibody

상품 한눈에 보기

Human PRKD2 단백질을 인식하는 rabbit polyclonal antibody. IHC 및 WB에서 orthogonal 및 independent validation 수행. PRKD2 단백질 발현 연구에 적합. 높은 특이성과 신뢰성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056727-100 Anti-PRKD2 Antibody, protein kinase D2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056727-25 Anti-PRKD2 Antibody, protein kinase D2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Protein kinase D2

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human PRKD2

DKFZP586E0820, HSPC187, PKD2

항목	내용
Target Protein	protein kinase D2
Target Gene	PRKD2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000041187 (78%), Rat ENSRNOG00000016434 (76%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand