Atlas Antibodies Anti-PRKAB1 Antibody

상품 한눈에 보기

Human PRKAB1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 정교한 직교 검증 수행. 고순도 친화정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004247-100 Anti-PRKAB1 Antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004247-25 Anti-PRKAB1 Antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: protein kinase, AMP-activated, beta 1 non-catalytic subunit
Supplier: Atlas Antibodies
Clonality: Polyclonal
Host: Rabbit

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human PRKAB1.

항목	내용
Target Protein	protein kinase, AMP-activated, beta 1 non-catalytic subunit
Target Gene	PRKAB1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW

Interspecies Information:
Highest antigen sequence identity to orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)