CacheBy
Atlas Antibodies Anti-PRICKLE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRICKLE3 Antibody

상품 한눈에 보기

Human PRICKLE3 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 보장. Human에 반응 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA000998-100 Anti-PRICKLE3 Antibody, prickle homolog 3 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000998-25 Anti-PRICKLE3 Antibody, prickle homolog 3 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRICKLE3 Antibody

Anti-PRICKLE3 Antibody

Target Information

  • Target Protein: prickle homolog 3 (Drosophila)
  • Target Gene: PRICKLE3
  • Alternative Gene Names: LMO6

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human PRICKLE3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LIFCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPATGPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000031145 79%
Rat ENSRNOG00000022417 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.