원본
Atlas Antibodies Anti-PRF1 Antibody
상품 한눈에 보기
Human PRF1 단백질을 인식하는 토끼 폴리클로날 항체로, perforin 1 (pore forming protein) 검출에 사용됩니다. 친화 정제된 고품질 항체로 다양한 응용에 적합하며, 인체 반응성이 검증되었습니다.
- 카탈로그번호
- HPA037940-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037940-100 Anti-PRF1 Antibody, perforin 1 (pore forming protein) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037940-25 Anti-PRF1 Antibody, perforin 1 (pore forming protein) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRF1 Antibody
Anti-PRF1 Antibody
Target: perforin 1 (pore forming protein)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human PRF1.
Alternative Gene Names
HPLH2, P1, PFP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | perforin 1 (pore forming protein) |
| Target Gene | PRF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000000562 (71%), Mouse ENSMUSG00000037202 (70%) |
Antigen Sequence:
HQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Recommended Applications
이미지에 표시된 내용: ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.