Atlas Antibodies Anti-PREP Antibody

상품 한눈에 보기

Human PREP 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제됨. 사람에 대해 검증된 반응성. 최적 조건은 사용자가 실험에 맞게 설정 필요.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031388-100 Anti-PREP Antibody, prolyl endopeptidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031388-25 Anti-PREP Antibody, prolyl endopeptidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Prolyl endopeptidase
Target Gene: PREP
Verified Species Reactivity: Human
Interspecies Identity:
- Mouse (ENSMUSG00000019849): 93%
- Rat (ENSRNOG00000051061): 92%

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IACVRSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDY

Polyclonal Antibody against Human PREP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Safety Information	Material Safety Data Sheet