CacheBy
Atlas Antibodies Anti-PREB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PREB Antibody

상품 한눈에 보기

Human PREB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. SEC12로도 알려진 PREB 단백질을 타깃하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 PBS 완충액에 보존되어 있습니다.

카탈로그번호
HPA014133-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014133-100 Anti-PREB Antibody, prolactin regulatory element binding 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014133-25 Anti-PREB Antibody, prolactin regulatory element binding 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PREB Antibody

Anti-PREB Antibody

Target: prolactin regulatory element binding (PREB)
Type: Polyclonal Antibody against Human PREB


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody targeting the human PREB protein, also known as SEC12.

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    REAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVP

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000045302): 90%
  • Rat (ENSRNOG00000007141): 90%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Alternative Gene Names SEC12

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.