Atlas Antibodies Anti-PRC1 Antibody

상품 한눈에 보기

Human PRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 직교 검증 완료. Human, Mouse, Rat 반응성 확인. PrEST 항원으로 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034521-100 Anti-PRC1 Antibody, protein regulator of cytokinesis 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034521-25 Anti-PRC1 Antibody, protein regulator of cytokinesis 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Protein regulator of cytokinesis 1

IHC (Immunohistochemistry)
WB (Western Blot)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human PRC1.

항목	내용
Target Protein	protein regulator of cytokinesis 1
Target Gene	PRC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000038943 (86%), Rat ENSRNOG00000013057 (84%)

Antigen Sequence:

KMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYV

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)