CacheBy
Atlas Antibodies Anti-PRAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRAM1 Antibody

상품 한눈에 보기

인간 PRAM1 단백질을 인식하는 폴리클로날 항체로, PML-RARA 조절 어댑터 분자 연구에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA050161-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050161-100 Anti-PRAM1 Antibody, PML-RARA regulated adaptor molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050161-25 Anti-PRAM1 Antibody, PML-RARA regulated adaptor molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRAM1 Antibody

Anti-PRAM1 Antibody

PML-RARA regulated adaptor molecule 1


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PRAM1 (PML-RARA regulated adaptor molecule 1).


Alternative Gene Names

  • PML-RAR

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein PML-RARA regulated adaptor molecule 1
Target Gene PRAM1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000032739 93%
Rat ENSRNOG00000039204 91%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.