CacheBy
Atlas Antibodies Anti-PRAC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRAC1 Antibody

상품 한눈에 보기

Human PRAC1 단백질을 인식하는 토끼 폴리클로날 항체로, 전립선암 관련 단백질 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.

카탈로그번호
HPA047871-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047871-100 Anti-PRAC1 Antibody, prostate cancer susceptibility candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047871-25 Anti-PRAC1 Antibody, prostate cancer susceptibility candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRAC1 Antibody

Anti-PRAC1 Antibody

Target Information

  • Target Protein: Prostate cancer susceptibility candidate 1
  • Target Gene: PRAC1
  • Alternative Gene Names: C17orf92, PRAC

Product Description

Polyclonal antibody against human PRAC1, generated in rabbit and affinity-purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000046679 (34%)
  • Rat ENSRNOG00000029260 (32%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Safety Information

Additional Resources

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.