Atlas Antibodies Anti-PRAC1 Antibody

상품 한눈에 보기

Human PRAC1 단백질을 인식하는 토끼 폴리클로날 항체로, 전립선암 관련 단백질 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047871-100 Anti-PRAC1 Antibody, prostate cancer susceptibility candidate 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047871-25 Anti-PRAC1 Antibody, prostate cancer susceptibility candidate 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human PRAC1, generated in rabbit and affinity-purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.