CacheBy
Atlas Antibodies Anti-PPY Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPY Antibody

상품 한눈에 보기

인체 PPY 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 발현 검증 제공. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human 반응성 확인 및 높은 특이성 보장. 연구용으로 최적화된 버퍼 구성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA032122-100 Anti-PPY Antibody, pancreatic polypeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032122-25 Anti-PPY Antibody, pancreatic polypeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPY Antibody

Anti-PPY Antibody

Target Information

  • Target Protein: Pancreatic polypeptide
  • Target Gene: PPY
  • Alternative Gene Names: PNP

Product Description

Polyclonal antibody against human pancreatic polypeptide (PPY).
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000017316 49%
Rat ENSRNOG00000020874 49%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications Immunohistochemistry (IHC), Orthogonal validation
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Enhanced Validation
Recommended Applications - IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.