Atlas Antibodies Anti-PPY Antibody

상품 한눈에 보기

인체 PPY 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 발현 검증 제공. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human 반응성 확인 및 높은 특이성 보장. 연구용으로 최적화된 버퍼 구성.

카탈로그번호: HPA032122-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032122-100 Anti-PPY Antibody, pancreatic polypeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032122-25 Anti-PPY Antibody, pancreatic polypeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PPY Antibody

Anti-PPY Antibody

Target Information

Target Protein: Pancreatic polypeptide
Target Gene: PPY
Alternative Gene Names: PNP

Product Description

Polyclonal antibody against human pancreatic polypeptide (PPY).
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000017316	49%
Rat	ENSRNOG00000020874	49%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC), Orthogonal validation
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.