CacheBy
Atlas Antibodies Anti-PPP2CA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP2CA Antibody

상품 한눈에 보기

Human PPP2CA 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB 실험에 적합합니다. Recombinant PrEST 항원을 이용해 Affinity 정제되었으며, Human, Mouse, Rat에 반응합니다. 안정적인 PBS/glycerol buffer로 보존됩니다.

카탈로그번호
HPA043236-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043236-100 Anti-PPP2CA Antibody, protein phosphatase 2, catalytic subunit, alpha isozyme 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043236-25 Anti-PPP2CA Antibody, protein phosphatase 2, catalytic subunit, alpha isozyme 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP2CA Antibody

Anti-PPP2CA Antibody

Target: protein phosphatase 2, catalytic subunit, alpha isozyme
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human PPP2CA.


Alternative Gene Names

  • PP2Calpha

Open Datasheet


Target Information

항목 내용
Target Protein protein phosphatase 2, catalytic subunit, alpha isozyme
Target Gene PPP2CA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000056485 (100%), Mouse ENSMUSG00000020349 (100%)

Antigen Sequence:
RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.