CacheBy
Atlas Antibodies Anti-PPP1R27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R27 Antibody

상품 한눈에 보기

인간 PPP1R27 단백질을 인식하는 토끼 다클론 항체로, 단백질 인산화효소 조절 단백질 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. 면역형광 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA042227-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042227-100 Anti-PPP1R27 Antibody, protein phosphatase 1 regulatory subunit 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042227-25 Anti-PPP1R27 Antibody, protein phosphatase 1 regulatory subunit 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R27 Antibody

Anti-PPP1R27 Antibody

Target: Protein phosphatase 1 regulatory subunit 27 (PPP1R27)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human PPP1R27.

Alternative Gene Names

DYSFIP1, toonin

Target Information

  • Target Protein: Protein phosphatase 1 regulatory subunit 27
  • Target Gene: PPP1R27

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000036690 93%
Mouse ENSMUSG00000025129 90%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Immunocytochemistry (ICC) and related immunoassays.

Notes

Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.