CacheBy
Atlas Antibodies Anti-PPP1R21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R21 Antibody

상품 한눈에 보기

Human PPP1R21 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, 신뢰성 높은 단백질 인식 성능을 제공합니다.

카탈로그번호
HPA036791-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036791-100 Anti-PPP1R21 Antibody, protein phosphatase 1, regulatory subunit 21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036791-25 Anti-PPP1R21 Antibody, protein phosphatase 1, regulatory subunit 21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R21 Antibody

Anti-PPP1R21 Antibody

Target: protein phosphatase 1, regulatory subunit 21
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human PPP1R21.


Alternative Gene Names

CCDC128, FLJ16566, KLRAQ1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 21
Target Gene PPP1R21
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence WMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDEATAKAVLEPIQSTSLIGTLTRTSDSEVPDVESREDL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000016528 78%
Mouse ENSMUSG00000034709 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.